SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000023387 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000023387
Domain Number 1 Region: 145-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000168
Family EGF-type module 0.008
Further Details:      
 
Domain Number 2 Region: 62-185
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000502
Family Growth factor receptor domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000023387   Gene: ENSLAFG00000025873   Transcript: ENSLAFT00000036785
Sequence length 283
Comment pep:novel supercontig:loxAfr3:scaffold_166:755395:759456:-1 gene:ENSLAFG00000025873 transcript:ENSLAFT00000036785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMAMWGSRELVLLWLLVLAASGVDHVCGANHVYQPGRRVCADRAPRGAVSESFVQRVYQP
FLTTCNGHRACSTYRTIYRIAYRRSPRPAPARPRYICCPGWKRTNRLPGACGAAVCQPPC
QNGGSCVWPGRCNCPAGWQGHTCQTDVDECSWGRGDCPQHCVNTAGSYRCQCQEGHRLSA
DGTLCLPMRGPPMVAPSRRPGVDREVEQEVQSLQSRVAVLEQKLQLVLAPLHSLASRALE
LGLPDPSSLLAHSFRQLERIDSLSEQISFLEEQLGACSCKKEL
Download sequence
Identical sequences G3UCP4
ENSLAFP00000025602 ENSLAFP00000023387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]