SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000023509 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000023509
Domain Number 1 Region: 265-402
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.5e-24
Family SPRY domain 0.00063
Further Details:      
 
Domain Number 2 Region: 4-76
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000131
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 89-149
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000134
Family B-box zinc-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000023509   Gene: ENSLAFG00000025555   Transcript: ENSLAFT00000029474
Sequence length 418
Comment pep:novel supercontig:loxAfr3:scaffold_18:14057156:14058765:1 gene:ENSLAFG00000025555 transcript:ENSLAFT00000029474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AASLANLQAEVSCLICLEYLRNSVTIDCGHNFCCCCIHQCWEGLEDIFPCPTCLHHCYKE
NLQNNTQLYHITDIVKQLPNKRTKRKWQEEKALCGKHNQVLVLFCEQDLELLCPQCRMSS
DHKNHYLMPIEQAGTSHRKKLKRYTESLREQAEDAEDGLEMQVSKLFELRQKVENLRREL
NEFNQLKNFLHQEWDAILQEKNGEEKLIGNNSQISDHFSVLKNLLSGAAEKCVWADLDLR
IGIESICNRCKNLKTPGNISGSKKRISTFKEDLTLDPETVHPLTISEDRKNIPYNPKRFA
FIPAVLSSEGCDVGRYYCICKGSFPRNGIMSPSAKDGCWQIQQATLIHGTWDTEQVIRIG
IFLDYDLGEVLFYSWDNRSYNYTITVTFTEKPRPYFSLGSTSNSLTTYINRSTDIISY
Download sequence
Identical sequences G3U6Q1
ENSLAFP00000023509 ENSLAFP00000023509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]