SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000023543 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000023543
Domain Number 1 Region: 207-381
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.43e-43
Family MAM domain 0.00031
Further Details:      
 
Domain Number 2 Region: 2-89
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000152
Family I set domains 0.044
Further Details:      
 
Domain Number 3 Region: 53-190
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000004
Family Fibronectin type III 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000023543   Gene: ENSLAFG00000029896   Transcript: ENSLAFT00000026725
Sequence length 418
Comment pep:novel supercontig:loxAfr3:scaffold_9:22248410:22390478:-1 gene:ENSLAFG00000029896 transcript:ENSLAFT00000026725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPAVEPAFLEIRQGQDRSVTMSCRVLRAYPIRVLTYEWRLGNKLLRTGQFDSQEYTEYPV
KSLSNENYGVYNCSIINEAGAGRCSFLVTGKAYAPEFYYDTYNPVWQNRHRVYSYSLQWT
QMNPDAVDRIVAYRLGIRQAGQQRWWEQEIKINGNIQKGELITYNLTELIKPEAYEVRLT
PLTKFGEGDSTIRVIKYSAPVNPHLREFHCGFEDGNICLFTQDDTDNFDWTKQSTATRNT
KYTPNTGPNADHSGSKEGFYMYIETSRPRLEGEKARLLSPVFSIAPKNPYGPTNTAYCFS
FFYHMYGQHIGVLNVYLRLKGQTTIENPLWSSSGNKGQRWNEAHVNIYPITSFQLIFEGI
RGPGIEGDIAIDDVSIAEGECAKQDLTTKNSVDGAVGILVHIWLFPVIVLISILSPRR
Download sequence
Identical sequences G3U6T5
ENSLAFP00000023543 ENSLAFP00000023543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]