SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000023644 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000023644
Domain Number 1 Region: 55-194
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-33
Family C-type lectin domain 0.0000333
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000023644   Gene: ENSLAFG00000021345   Transcript: ENSLAFT00000027987
Sequence length 196
Comment pep:novel supercontig:loxAfr3:scaffold_57:14656475:14666526:-1 gene:ENSLAFG00000021345 transcript:ENSLAFT00000027987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKNGLIVCILVVTLLLDQTTSHTSKLKARKHSKRRAKADDGDLKTQVEKLWREVNALKE
IQALQTVCLRGTKVQKKCYLASDGLKNFHEANEDCISKGGTLVVPRNSDEISSLLDYGKK
SLPGVNDFWLGINDMAAEGKFRDVNGIAISFLNWDRAQPNGGKRENCVLFSQSAQGKWNV
EVCGSSKRYICEFIIP
Download sequence
Identical sequences G3TQQ1
ENSLAFP00000017898 ENSLAFP00000023644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]