SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000023682 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000023682
Domain Number 1 Region: 491-656
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 3.53e-70
Family A middle domain of Talin 1 0.000000316
Further Details:      
 
Domain Number 2 Region: 2302-2492
Classification Level Classification E-value
Superfamily I/LWEQ domain 6.67e-51
Family I/LWEQ domain 0.00012
Further Details:      
 
Domain Number 3 Region: 1847-1980
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.1e-44
Family VBS domain 0.00000908
Further Details:      
 
Domain Number 4 Region: 1233-1369
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.49e-41
Family VBS domain 0.028
Further Details:      
 
Domain Number 5 Region: 775-897
Classification Level Classification E-value
Superfamily I/LWEQ domain 2.55e-36
Family I/LWEQ domain 0.00000749
Further Details:      
 
Domain Number 6 Region: 197-311
Classification Level Classification E-value
Superfamily Second domain of FERM 2.09e-31
Family Second domain of FERM 0.00000143
Further Details:      
 
Domain Number 7 Region: 661-787
Classification Level Classification E-value
Superfamily I/LWEQ domain 4.9e-29
Family I/LWEQ domain 0.0000898
Further Details:      
 
Domain Number 8 Region: 1082-1215
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 4.87e-28
Family VBS domain 0.011
Further Details:      
 
Domain Number 9 Region: 312-402
Classification Level Classification E-value
Superfamily PH domain-like 1.24e-24
Family Third domain of FERM 0.0000172
Further Details:      
 
Domain Number 10 Region: 1477-1563
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000000000000127
Family I/LWEQ domain 0.0092
Further Details:      
 
Domain Number 11 Region: 2012-2139
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000000137
Family VBS domain 0.013
Further Details:      
 
Domain Number 12 Region: 81-138
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000106
Family Ubiquitin-related 0.09
Further Details:      
 
Domain Number 13 Region: 1704-1822
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000722
Family VBS domain 0.037
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000023682
Domain Number - Region: 952-1050
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000149
Family I/LWEQ domain 0.0029
Further Details:      
 
Domain Number - Region: 1593-1667
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000361
Family VBS domain 0.041
Further Details:      
 
Domain Number - Region: 2114-2235
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0392
Family I/LWEQ domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000023682   Gene: ENSLAFG00000000520   Transcript: ENSLAFT00000026680
Sequence length 2547
Comment pep:novel supercontig:loxAfr3:scaffold_59:8522246:8724363:1 gene:ENSLAFG00000000520 transcript:ENSLAFT00000026680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALSLKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASDYGLFLSDEDPRK
GIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGTVKTVMVDDSKTVGELLVTICSR
IGITNYEEYSLIQETMEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSR
TFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEF
GGFQAQIQFGPHVDHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKAK
YVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGVTKDSVMRVDEKTKEVLQEWPLTTVK
RWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEES
TMLEESVSPKKSTILQQQFNRTGKVEHGSVALPAVMRSGSSGPETFNVGSMPSPQQQVTV
GQMHRGHMPPLTSAQQALMGTINTSMHAVQQAQDDLSELDSLPPLGQDMASRVWVQNKVD
ESKHEIHSQVDAITAGTASVVNLTAGDPADTDYTAVGCAITTISSNLTEMSKGVKLLAAF
MDDEVGSGEDLLRAARTLAGAVSDLLKAVQPTSGEPRQTVLTAAGSIGQASGDLLRQIGE
NETDERFQDVLMSLAKAVANAAAMLVLKAKNVAQVAEDTVLQNRVIAAATQCALSTSQLV
ACAKFLRADLGAPLWTSRMSYLHLYTVPAHNGVLHYAQRQHKWAQCILKGSGMFSAAASV
VSQALPRLPAALCDSLPAVVNPLGRYDQATDTIMCVTESIFSSMGDGLGEMVRQARVLAQ
ATSDLVNAMRSDAEAEIDMENSKKLLAAAKLLADSTARMVEAAKGAAANPENEDQQQRLR
EAAEGLRVATNAAAQNAIKKKIVNRLEVAAKQAAAAATQTIAASQNAAVSNKNPAAQQQL
VQSCKAVADHIPQLVQGVRGSQAQAEDLSAQLALIISSQNFLQPGSKMVSSAKAAVPTVS
DQAAAMQLSQCAKNLATSLAELRTASQKAHEACGPMEIDSALSTVQTLKNELQDAKMAAA
ESQLKPLPGETLEKCAQDLGSTSKAVGSSMAQLLTCAAQGNEHYTGVAARETAQALKILA
QAARGVAASTSDPSAAHAMLDSARDVMEGSAVLIQEAKQALIAPGDAESQQRLAQVAKAV
SHSLNNCVNCLPGQKDVDVALKSIGESSKKLLVDSLPPSTKPFQEAQSELNQAAADLNQS
AGEVVHATRGQSGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQIQVIGNLKNISMAS
SKLLLAAKSLSVDPGAPNAKNLLAAAARAVTESINQLITLCTQQAPGQKECDNALRELET
VKGMLDNPNEPVSDLSYFDCIESVMENSKVLGESMAGISQNAKTGDLPAFGECVGVASKA
LCGLTEAAAQAAYLVGISDPNSQAGHQGLVDPIQFARANQAIQMACQNLVDPGSSPSQVL
SAATIVAKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSE
DNRNKCRIATAPLIEAVENLTAFASNPEFVSVPAQISSEGSQAQEPILVSAKTMLESSSY
LIRTARSLAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDISIDGINRCI
RDIEQASLAAVSQSLATRDDISVEALQEQLTSVVQEIGHLIDPITTAARGEAAQLGHKVT
QLASYFEPLVLAAVGVASKILDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKQAQHT
HDAIMEAAQLMKEAVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGSPPEPKGTFVD
YQTTGVKYSKAIAVTAQEMMTKSVTNPEELGGLASQMTSDYGHLALQGQMAAATAEPEEI
GFQIRTRVQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARAVTEKVSLMLAALQAGQ
GTQACITAAFCVSGIIAELDTTIMFATAGTLNAENNETFADHRENILKTAKALVEDTKLL
VSGAASTPEKLAQAAQSSAATITQLAEVVKLGAASLGSDDPETQVVLINAIKDVAKALSD
LIGATKGAASKPADDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIEYI
KQELTVFQSKEVPEKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVS
DMLTACKQASFHPDVSEEVRTRALRFGTECTLGYLDLLEHVLVILQKPTPELKHQLAAFS
KRVAGAVTELIQAAEAMKGTEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPK
QADETLDFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGSIPANAADDGQWSQGL
ISAARMVAAATSNLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAM
RRLQAAGNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKFVGGIAQIIAAQEEMLKKERE
LEEARKKLAQIRQQQYKFLPTELREDE
Download sequence
Identical sequences G3U774
ENSLAFP00000023682 ENSLAFP00000023682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]