SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000023696 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000023696
Domain Number 1 Region: 32-128
Classification Level Classification E-value
Superfamily SH2 domain 4.71e-23
Family SH2 domain 0.00027
Further Details:      
 
Domain Number 2 Region: 179-226
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000549
Family SOCS box-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000023696   Gene: ENSLAFG00000025968   Transcript: ENSLAFT00000031771
Sequence length 228
Comment pep:novel supercontig:loxAfr3:scaffold_49:4513057:4513743:1 gene:ENSLAFG00000025968 transcript:ENSLAFT00000031771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPAGAPSASSPPPEPSSPSSEVPEQPPAQPPTGSTPRKAYYIYSGGEKIPLV
LSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
Download sequence
Identical sequences G3U788
ENSLAFP00000023696 ENSLAFP00000023696 XP_010595219.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]