SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000023783 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000023783
Domain Number 1 Region: 421-559
Classification Level Classification E-value
Superfamily TIMP-like 3.06e-24
Family Netrin-like domain (NTR/C345C module) 0.011
Further Details:      
 
Domain Number 2 Region: 366-427
Classification Level Classification E-value
Superfamily BPTI-like 1.56e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0022
Further Details:      
 
Domain Number 3 Region: 197-290
Classification Level Classification E-value
Superfamily Immunoglobulin 6.65e-17
Family I set domains 0.023
Further Details:      
 
Domain Number 4 Region: 113-163
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000104
Family Ovomucoid domain III-like 0.035
Further Details:      
 
Domain Number 5 Region: 310-366
Classification Level Classification E-value
Superfamily BPTI-like 0.000000284
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0092
Further Details:      
 
Domain Number 6 Region: 35-83
Classification Level Classification E-value
Superfamily Elafin-like 0.00000196
Family Elafin-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000023783   Gene: ENSLAFG00000006460   Transcript: ENSLAFT00000006460
Sequence length 566
Comment pep:novel supercontig:loxAfr3:scaffold_53:15264412:15266954:-1 gene:ENSLAFG00000006460 transcript:ENSLAFT00000006460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAPLLLIRLLTVLAAATSGLVARASLPPPPPESRSHPGVCPNQLNPHLWVDAQSTCEQE
CLGDQDCAAPERCCPNVCGLRSCVAARFAPGGPTAPAATTCEGFVCLQQGSDCDIWNGQP
VCRCRERCGKEPSFTCASDGLTYYNRCYLDAEACLRGLRLHVVPCKSVLGWPPSSLSPRD
PETARPMLGEPVVPETPPCTASPSPQAVAIGGTALNCDVSGRPSPTITWERQSEQEENLI
LRPDQMYGNVVVTSIGQLVLYNARLEDAGLYTCTARNAAGLLRADFPLSVVQWGVAAESP
LHAPGVPALAGAKCSHPPDTQPCPGSAGPSMLWRFDPRRGGCATFKARGCDEGAGGGFRT
YEACQACAPGPGDACVLPAVRGPCLGHEMRWVYSPLLRQCHLFVYGGCEGNGNNFESREA
CEDACPMPRTLPCRTCRLRSRLALSLCRSDFAIVGRLTEVLQEPEATGGGGIARVALDDV
LKDDKMGLQFLGTKYLEVTLLGVDWACPCPNVTAGDGPLVIMGEVRDGMAVLDASSYVRA
ASEKRVKKIAELMEKKACELLKRFQD
Download sequence
Identical sequences G3U7H5
ENSLAFP00000023783 ENSLAFP00000023783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]