SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000023840 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000023840
Domain Number 1 Region: 554-616
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.96e-21
Family Complement control module/SCR domain 0.0052
Further Details:      
 
Domain Number 2 Region: 496-555
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000223
Family Complement control module/SCR domain 0.00079
Further Details:      
 
Domain Number 3 Region: 244-299
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000243
Family Complement control module/SCR domain 0.00086
Further Details:      
 
Domain Number 4 Region: 184-241
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000486
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 5 Region: 117-179
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000603
Family Complement control module/SCR domain 0.0031
Further Details:      
 
Domain Number 6 Region: 364-419
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000113
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 7 Region: 423-489
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000249
Family Complement control module/SCR domain 0.00015
Further Details:      
 
Domain Number 8 Region: 63-127
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000734
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 9 Region: 10-67
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000017
Family Complement control module/SCR domain 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000023840
Domain Number - Region: 307-358
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0229
Family Complement control module/SCR domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000023840   Gene: ENSLAFG00000027057   Transcript: ENSLAFT00000028860
Sequence length 617
Comment pep:novel supercontig:loxAfr3:scaffold_16:85236:114383:-1 gene:ENSLAFG00000027057 transcript:ENSLAFT00000028860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETCSKSDTNIVNGFISEPRHTYPVYYQTQYKCKPGYVTAEGKTSGPITCLESGWSTQPIC
IKSCDMPFFENARAKSNGTWFKLNDQMDYECSAGYENTGGSTTGSIVCGDDGWSDTPTCY
ERECSVPGIPPNLDASPKKDKYKVGDVLQFSCKQRSKRVGADSIQCYHFGWSPNPPTCKG
QVSSCGPPPQLLNGDVKGTKKEKYEHNDVVEYGCNPRFLMKGSKKIQCVDGEWTALPICV
EEESTCGDIPILEHGYSLPSDPPYHHGDSVEFTCKESFTMIGYRLITCVSGMWSQLPQCV
ATEQLEKCKLSRIVGSYSRLSDQTEINHNTNFSYRCRGKSEYKQSTCINGRWDPKLTCTE
EKKQLCPPPPHIPNARNMTITVNYQEGEKISILCQENYLIQKTNEIVCKDGRWQSIPRCV
ENILCSLPPHIKHGKINLSRFSEVRKETSTPRSYSHGTKLTYICEDGFKLSEEDGITCHA
GKWSSPPQCVDSEGKCGPPPPIENGDITSFPLPTYAQGSTVEYQCQNLYELQGNKHITCT
KGQWSEPPKCLDACVISEEMMEKHNIKLKWKYDKKIYSKTGDTVEFTCKQGYTEKTPRET
FQATCQEGKLKYPSCEK
Download sequence
Identical sequences G3U7N2
ENSLAFP00000023840 ENSLAFP00000023840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]