SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000024061 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000024061
Domain Number 1 Region: 100-196
Classification Level Classification E-value
Superfamily C-type lectin-like 3.5e-21
Family C-type lectin domain 0.00000447
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000024061
Domain Number - Region: 47-69
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.000471
Family Triple coiled coil domain of C-type lectins 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000024061   Gene: ENSLAFG00000027813   Transcript: ENSLAFT00000032826
Sequence length 199
Comment pep:novel supercontig:loxAfr3:scaffold_12:22494855:22499846:-1 gene:ENSLAFG00000027813 transcript:ENSLAFT00000032826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELWGAYLFLCLLSFLPQVMAEPPTPKAKKAANAKKEVVSPKMFEELKSQLDSLAQEVAL
LKEQQALQTGSLLKGTKVHMKCFLPLPRPRPSTRRARIAGTLGTPQTGSENDALYEYLRQ
SVGAEAEIWLGLNDMADEGAWVDMTGGPIAYKNWETEITAQPDGGKAENCAVLSAAAAGR
WFDKRCRDKLPYVCQFGIV
Download sequence
Identical sequences G3U8A3
ENSLAFP00000024061 ENSLAFP00000024061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]