SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000024145 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000024145
Domain Number 1 Region: 283-459
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-59
Family SPRY domain 0.0000211
Further Details:      
 
Domain Number 2 Region: 4-72
Classification Level Classification E-value
Superfamily RING/U-box 6.45e-23
Family RING finger domain, C3HC4 0.0072
Further Details:      
 
Domain Number 3 Region: 88-147
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000427
Family B-box zinc-binding domain 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000024145
Domain Number - Region: 133-236
Classification Level Classification E-value
Superfamily Apolipoprotein 0.034
Family Apolipoprotein 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000024145   Gene: ENSLAFG00000026323   Transcript: ENSLAFT00000026079
Sequence length 464
Comment pep:novel supercontig:loxAfr3:scaffold_905:8870:10264:1 gene:ENSLAFG00000026323 transcript:ENSLAFT00000026079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALAGIQAEASCPICLDYFRDPVTIKCGHNFCRSCIQQSWQDQQDWFQCPVCRHPWLQLHL
RSNTQLGNIAEIAKLLHITRSKRKREEETRLCKKHNQVLTHFCEEDLEVLCSLCTQPPNH
QDHLVRSIEEAASHHRKRLMSYMEPLKKQMADIQKLITSQDREPSELRKKVEKQRKELLS
EFEHLNKFLDREHEAALSRLAYEEKHVQQKLNANITAFSESISTLNSLLKEVAEKSVMSE
VKLLTDIQSIQDRCEGLNPPVLYSFQLTKEGCSLPPQYSALQKIIQKFKEDVTLDPETAH
SNLIVSEDKKSVTFVKKTQRLPPNPKRFKFDPVVLGCEEFSSGRHYWEVEVGEKPEWSVG
LCKDSLSRKAKRPPAGQERCWAIQLCNGNYVAQGTFPVTLVITEKPRGIGIYLDYELGEI
SFYSLNDRSHIYSFTDRFSEILKPYFCIGRDSQPLTICAVRDYE
Download sequence
Identical sequences G3U8I7
ENSLAFP00000024145 ENSLAFP00000024145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]