SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000024153 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000024153
Domain Number 1 Region: 225-322
Classification Level Classification E-value
Superfamily Immunoglobulin 1.74e-30
Family C1 set domains (antibody constant domain-like) 0.0000893
Further Details:      
 
Domain Number 2 Region: 118-221
Classification Level Classification E-value
Superfamily Immunoglobulin 3.68e-23
Family C1 set domains (antibody constant domain-like) 0.0000165
Further Details:      
 
Domain Number 3 Region: 4-102
Classification Level Classification E-value
Superfamily Immunoglobulin 1.63e-21
Family C1 set domains (antibody constant domain-like) 0.000045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000024153   Gene: ENSLAFG00000028320   Transcript: ENSLAFT00000031915
Sequence length 400
Comment pep:novel supercontig:loxAfr3:scaffold_57:2969742:2973683:1 gene:ENSLAFG00000028320 transcript:ENSLAFT00000031915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASTKAPSVFPLAPGCGTTPESKVALACLVANYFPEPVTVSWNSGALSGAHTFPAVLQSSG
LYSLTSTVTVPAPWTRRPYVCNVAHPASNTKVDKKIVPRHPDVCSEFKSRCLAPELIGGP
SIFIFPPKPKDTLMISRSPEVTCLVVDLGQDNLEVEFSWFVDGEQVHKAKTSVQEEQFNS
TYRVVSALPITQQDWLKGKEFKCKVNNSALPTPVEKVISKAKGQPHEPQVYVLPPHQDEL
TEDKVTLTCLVKGFYPSDIDVTWQRNQQPEPENSYENTEAHLEANGTFFLYSKLTVPKDR
WQQGDTYSCVVLHETLPSHRIQKTISLSPELHPEESCAEAQDGELDGLWTTISIFITLFL
LSVCYSATITFFKVKWIFSSVVELKRTIAPDYRNMIGQAA
Download sequence
Identical sequences G3U8J5
ENSLAFP00000024153 ENSLAFP00000024153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]