SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000024337 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000024337
Domain Number 1 Region: 117-178
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000116
Family Complement control module/SCR domain 0.0000817
Further Details:      
 
Domain Number 2 Region: 16-75
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000416
Family Complement control module/SCR domain 0.0000708
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000024337   Gene: ENSLAFG00000007463   Transcript: ENSLAFT00000036794
Sequence length 275
Comment pep:novel supercontig:loxAfr3:scaffold_15:40749471:40763933:1 gene:ENSLAFG00000007463 transcript:ENSLAFT00000036794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPSELLISFFFSFAEFCYDGPPEIRYATFKAHTYKNGTILNCECKKGFRRIRNGSPYILC
TGNSSHVSWENKCQCMSNSPWYTEKQVTSKPEQEEERKSSEMQSQMQLLDQASLPGHCRE
PPPWEHEAMERKYHFVVGQTVQYQCIKGYRAQRRGRAESTCRVICGETRWTQPRLTCTNE
VIPGSYFHKHGLLSSPGKEEAESSTDTLPESEASCPSITTVSQKYTEAVTTTETFIFTTE
YQIAVASCVFLLISILLLSVFTWQRKCRREKREKI
Download sequence
Identical sequences G3UND7
ENSLAFP00000029346 ENSLAFP00000024337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]