SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000024553 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000024553
Domain Number 1 Region: 2-141
Classification Level Classification E-value
Superfamily RUN domain-like 1.28e-36
Family RUN domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000024553   Gene: ENSLAFG00000006978   Transcript: ENSLAFT00000006977
Sequence length 395
Comment pep:novel supercontig:loxAfr3:scaffold_31:25514934:25519884:1 gene:ENSLAFG00000006978 transcript:ENSLAFT00000006977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSSEEFVNFAAILEQILSHRFKACAPAGPVSWFSSDGQRGFWDYIRLACSKVPNNCVSSI
ENMENISTARAKGRAWIRVALMEKRMSEYITTALRDTRTTRRFYDSGAIMLREEATVLTG
MLIGLSAIDFSFCLKGEVLDGKTPVVIDYTPYLKFTQRSYDYLTDEEERHSAESSTSEDN
SPEHPYLPLVTDEDSWYSKWHKMEQKFRIVYAQKGYLEELVRLRESQLKDLEAENRRLQL
QLEEAAAQNQREKRELEGVILELQEQLTGLIPGDHAPLTQGSKELTTPLVNQWPSLGTLS
GAEGAHNPKLYRRHSFMSTEPLSAEASLSSDSQRLGDCKRDEEPWGPIGKDPTPSMLGLC
GSLASIPSCKSLASFKSNECLVSDSPEGSPALSPS
Download sequence
Identical sequences G3U9P5
ENSLAFP00000024553 ENSLAFP00000024553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]