SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000024712 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000024712
Domain Number 1 Region: 8-157
Classification Level Classification E-value
Superfamily C-type lectin-like 3.5e-38
Family C-type lectin domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000024712   Gene: ENSLAFG00000029174   Transcript: ENSLAFT00000028462
Sequence length 160
Comment pep:novel supercontig:loxAfr3:scaffold_15:52753478:52755563:-1 gene:ENSLAFG00000029174 transcript:ENSLAFT00000028462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFNIMNTLKITLLMLYLYVLLPNIGKGWGCCPENWIASNTSCYFISFKLSNWTESEKNCA
GVGAHLLVINTKEEQLLIYQKLDKRFAYYMGLSDPERTYQWQWVDQSPYDKSVTFWHPGE
PSDNNEHCVFINSVKANWGWNNAPCHESQNSVCEMMKIYL
Download sequence
Identical sequences G3UA54
ENSLAFP00000024712 ENSLAFP00000024712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]