SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000024776 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000024776
Domain Number 1 Region: 146-255
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-33
Family Spermadhesin, CUB domain 0.00045
Further Details:      
 
Domain Number 2 Region: 302-415
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-33
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 3 Region: 466-578
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 3.01e-28
Family Frizzled cysteine-rich domain 0.00029
Further Details:      
 
Domain Number 4 Region: 260-296
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000106
Family LDL receptor-like module 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000024776
Domain Number - Region: 419-452
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000223
Family LDL receptor-like module 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000024776   Gene: ENSLAFG00000000881   Transcript: ENSLAFT00000028827
Sequence length 581
Comment pep:novel supercontig:loxAfr3:scaffold_58:6990500:6995489:-1 gene:ENSLAFG00000000881 transcript:ENSLAFT00000028827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDYSDVILCVEATELSKTEFCNPAFEPESGSLCPPPAFQEDASCSLQAPWHGRRPQGPQ
PDCHFSWLCVLLLTGLLLLLLGLLVAVILARLQATPPSAASYSPLPSPGLGTTTMTTLTT
ITTSQATGTPQGQQEAGMSPTPHSTCGGLLFGPKGFFSSPNYPDPYPPNTHCVWHIQVAP
GHAIQLKIDTLSMESVASCLFDRLEISPEPEGPLLRVCGKLPPPTLNTNASRLRVAFASD
SSVEGLGFHAWYQAVAPGQGSCAHDEFPCDQLLCLLPDSVCDGFANCADGSDEANCSAEF
PGCGGNLTGLQGTFSTPNQLQLYPHQQLCMWYVSVPPGHHIELEFHNFSLEVQDECKLDY
VEVYETSNSGALSLLGRFCGAEPPPRLVSSHHELAVLFRTDHGISSGSFSATYQALNATD
NPCGSRELSCQDGGCKDLQWMCNVWRDCTEGNSDNCSSPLFPPPELACEPVQVEMCVGLS
YNTTAFPNIWVGMATQEEVVEVLKGYKSLTSLPCYQNFRRLLCGLLVPRCTPLGSVLPPC
RSVCQEAERQCQSGLALLGTPWPFNCNRLPEAAGLEACAQP
Download sequence
Identical sequences G3SMI8
ENSLAFP00000000735 ENSLAFP00000024776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]