SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000024841 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000024841
Domain Number 1 Region: 43-198
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-21
Family MAM domain 0.016
Further Details:      
 
Domain Number 2 Region: 239-338
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000013
Family MAM domain 0.026
Further Details:      
 
Domain Number 3 Region: 6-38
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000275
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000024841   Gene: ENSLAFG00000030673   Transcript: ENSLAFT00000032197
Sequence length 351
Comment pep:novel supercontig:loxAfr3:scaffold_15:25394742:25495902:-1 gene:ENSLAFG00000030673 transcript:ENSLAFT00000032197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVQQGTEDFQCDNGVPLPLDNVCDFTDQCGDNSDEQPCSNYERCDFEDGLCTMTQDQSLQ
LGWTKRNGMSDTSPPFYDHNGDMSAHFLSLVTRLDSTSSNLRSRIFLPTNKQNACQVTFY
HFFSQVSGKLMVGLQTACDSAIQHLWQNTAGLKDAWERNVIKIHSSQRFQIVIHGQMISA
HEQNEVIAIDDISFSPGCLPANTDESLQCQETSNTKQELCNPDTNLCQFDSTDGGLRLCQ
ACGFEFGMCDWSSEVSAGQISWTLTKAREVPALESTPRQDQSGDDEGYYVWIGAKQTFNH
LDSKAYLNSSVCHCLGKGCHLQFYYSLEESVLRVGLYNNKVRRHLYLFQIH
Download sequence
Identical sequences G3UAI3
ENSLAFP00000024841 ENSLAFP00000024841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]