SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000024902 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000024902
Domain Number 1 Region: 2-156
Classification Level Classification E-value
Superfamily RUN domain-like 7.19e-42
Family RUN domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000024902   Gene: ENSLAFG00000030116   Transcript: ENSLAFT00000027736
Sequence length 157
Comment pep:novel supercontig:loxAfr3:scaffold_3:8861592:8864259:-1 gene:ENSLAFG00000030116 transcript:ENSLAFT00000027736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIRDLKAAISAIVQAYGNGQESVTDASAELHRLCGCLELLLQFDQKEQKSFRRPRKDYWD
FLSTALWQQRRDMEPARFVHSQDKLKTPLGKGRAFIRFCLARGQLAESLQLCLLNPELTR
EWYGPRSPLVCPELQEDILDSLYALNGVAFDLDLQRP
Download sequence
Identical sequences G3UAP4
ENSLAFP00000024902 ENSLAFP00000024902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]