SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000024973 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000024973
Domain Number 1 Region: 9-89
Classification Level Classification E-value
Superfamily RING/U-box 6.09e-21
Family RING finger domain, C3HC4 0.021
Further Details:      
 
Domain Number 2 Region: 89-150
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 7.48e-16
Family B-box zinc-binding domain 0.0012
Further Details:      
 
Domain Number 3 Region: 280-346
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000265
Family SPRY domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000024973   Gene: ENSLAFG00000028799   Transcript: ENSLAFT00000032854
Sequence length 346
Comment pep:novel supercontig:loxAfr3:scaffold_237:93778:100251:1 gene:ENSLAFG00000028799 transcript:ENSLAFT00000032854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAPMAPAKPLAMMWEEVTCRVCLDPFVEPVIIECGHSFCQKCISEVGKDGGSSCPVCQQK
FLFRNIWPNQHLASMVHILRQMVQSTKEDMKRDQCRVHGEKLHLFCEEDGEALCWVCAHS
RKHRDHSIVPTEEATHEYQEKFPVALQKLRRERELAELEVDIAEKRAAWKRKVETQKSRI
HTEFVQQRNFLAKEEERQLQKLEKDERDQPRILGETEAQLAQKSQALQVLISELKRLWGP
VLVLLQEAQSILERSEAWNRKELGVASPDLRNECRVPGLKKMLRTYGVHITPKPDTASLW
LSLSEDQRIVKLGDTCQNVPVLSAQCFDSGRLYWEVDMTGNEAWDL
Download sequence
Identical sequences G3UAW5
ENSLAFP00000024973 ENSLAFP00000024973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]