SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000025061 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000025061
Domain Number 1 Region: 30-208
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-65
Family SPRY domain 0.0000094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000025061   Gene: ENSLAFG00000026083   Transcript: ENSLAFT00000034616
Sequence length 222
Comment pep:novel supercontig:loxAfr3:scaffold_138:462079:463236:1 gene:ENSLAFG00000026083 transcript:ENSLAFT00000034616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PMPHNTIKNWRKELFQAVPRVILSFLEVKQVIIFAVNVSLDPDTAHPNLILSEDRRRVTW
EEKPRDLPDDPQRFVSLPCVLGQQVISSGRRYWEVEVGDIGAWDLGICRDNVMRKGRVFL
KPQDGFWAIRLYNNEYWALTSPETQLTPKKHPARVCIFLEYEDRRISFYNMTDKFHIHTF
NQCLFYGSLRPFFRLWSADSGHLTICPVSETAQPDDDPHRVP
Download sequence
Identical sequences G3UMX5
ENSLAFP00000029184 ENSLAFP00000025061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]