SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000025353 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000025353
Domain Number 1 Region: 31-175
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000015
Family C-type lectin domain 0.004
Further Details:      
 
Domain Number 2 Region: 252-283
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000103
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000025353   Gene: ENSLAFG00000015731   Transcript: ENSLAFT00000030458
Sequence length 462
Comment pep:novel supercontig:loxAfr3:scaffold_9:13985801:13987236:-1 gene:ENSLAFG00000015731 transcript:ENSLAFT00000030458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPALALCLLWQALCPGPGRGEHPIADRAICSPSGVCYSLHHATIQRQAAEEACSLRGGA
LTTVHGGPELRAVLALLRAGPGPGGGSKDLLFWVALERKKSCCTQENEPLRGFSWLWPDG
YGSESETLQWVEEPQRSCTVRRCAGLQATGGVDPAGWKEMRCHLRADGYLCKYQFEGLSN
LSYLAPFRLHSAALDFSPPGTEVSALCPGQLWVSASCVVDEVGTHWDGLPSGGLLCPCPG
RYLRAGKCAELPNCLEDLGNFTCECAPGFELSKDGRSCVTSGEGQPTPGETKEATRRPQV
TAATPVPRRTGSPTGHEKPGEIPFVSGRGSSSTSIPEIPQPGASSTMSTLHTSPQAKSED
TISPSGSEIPKFNTTFSSATPQTFDSSSTIVFILVSIAVVVLVILIMTVLGLFKLCFHKS
PPSRPRKGPLATPRVESEAEATASHTNSAHCTDNGVMIRDCG
Download sequence
Identical sequences G3TFR2
ENSLAFP00000013192 ENSLAFP00000025353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]