SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000025459 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000025459
Domain Number 1 Region: 159-310
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000169
Family Growth factor receptor domain 0.0064
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000025459
Domain Number - Region: 125-157
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0257
Family EGF-type module 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000025459   Gene: ENSLAFG00000030332   Transcript: ENSLAFT00000030296
Sequence length 311
Comment pep:novel supercontig:loxAfr3:scaffold_176:403971:414155:-1 gene:ENSLAFG00000030332 transcript:ENSLAFT00000030296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSPDGLPTPRSRCRGLVKKFKQGMVDTEKKNFGGGNTAWEEKSLSKYEFSEIRLVEILEG
LCESSDFECNRMVEEQEEHLEAWWLRLKKQSPDLFEWFCVETLKVCCSPGTFGPDCLACP
GGTQRPCSGNGLCSGDGSRQGDGSCQCHMGYRGALCMDCVDGYFSALRNDTHSVCTVCNE
ACKTCTGPTSRDCAECDVGWARQQDDCIDVNECAEETPPCSEGQYCENVPGSYTCEECDS
TCVGCTGKGPGKCTACVPGYTKEENGQCSDVDECSQTEKPCARDNENCYNTPGSFVCVCP
EGYEETDEACV
Download sequence
Identical sequences G3UCA1
ENSLAFP00000025459 ENSLAFP00000025459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]