SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000025482 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000025482
Domain Number 1 Region: 283-459
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-58
Family SPRY domain 0.0000226
Further Details:      
 
Domain Number 2 Region: 4-72
Classification Level Classification E-value
Superfamily RING/U-box 7.69e-23
Family RING finger domain, C3HC4 0.0081
Further Details:      
 
Domain Number 3 Region: 88-147
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000351
Family B-box zinc-binding domain 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000025482
Domain Number - Region: 133-236
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0628
Family Apolipoprotein 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000025482   Gene: ENSLAFG00000030115   Transcript: ENSLAFT00000025683
Sequence length 464
Comment pep:novel supercontig:loxAfr3:scaffold_37:126356:127750:1 gene:ENSLAFG00000030115 transcript:ENSLAFT00000025683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALAGIQAEANCPICLDYFRDPVTIKCGHNFCRSCIQQSWQDQQDWFRCPVCRHPWLQLHL
RSNTQLGNIAEIAKLLHITRSKRKREEETRLCKKHNQELTHFCEEELEVLCSLCTQPPNH
QDHLVRSIEEAASHHRKRLISYMEPLKKQVADFQKLVTSQDREPSELRKKVEKQRKELFS
EFEHLNKFLDREREAALSRLAYEEKHIQQKLNANITAFSESISTLNSLLKEVAEKSVMSE
VKLLTDIKSLQNRCENLNPPVLYSFQLTKEGCSLPPQYSALQKIIQKFKEDVTLDPETAH
SNLIVSEDKKSVTFVKKTQRLPPNPKRFKFDPVVLGREEFSSGRHYWEVEVGEKPEWSVG
LCKDSLSRKAKRPPAGQERCWAIQLCNGNYVARGTFPVTLMITEQPRGIGIYLDYELGEI
SFYSLNDRSHIFSFTDRFSEILKPYFCIGRDSQPLTICAVRDYE
Download sequence
Identical sequences G3UCC4
ENSLAFP00000025482 ENSLAFP00000025482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]