SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000025560 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000025560
Domain Number 1 Region: 823-929
Classification Level Classification E-value
Superfamily SRCR-like 6.02e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000572
Further Details:      
 
Domain Number 2 Region: 268-372
Classification Level Classification E-value
Superfamily SRCR-like 1.31e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000696
Further Details:      
 
Domain Number 3 Region: 414-519
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-44
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000625
Further Details:      
 
Domain Number 4 Region: 102-205
Classification Level Classification E-value
Superfamily SRCR-like 3.14e-44
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000496
Further Details:      
 
Domain Number 5 Region: 949-1058
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-33
Family Spermadhesin, CUB domain 0.00049
Further Details:      
 
Domain Number 6 Region: 66-99
Classification Level Classification E-value
Superfamily SRCR-like 0.00000288
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000025560   Gene: ENSLAFG00000027577   Transcript: ENSLAFT00000035008
Sequence length 1391
Comment pep:novel supercontig:loxAfr3:scaffold_72:362287:417783:1 gene:ENSLAFG00000027577 transcript:ENSLAFT00000035008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTSTFILGVCLLWGQILTAGSQVCLSTCPRMWEQGWYVRNEHFCPPEMPAMCFRRVCSR
RAYAGLPLKLADRGSWCQGHVGVLYQGYWGSVCVDSWTESGLALRLVNGGDRCQGRVEVL
YRGSWGTVCDDLWDTNDANVVCRQLGCGWAISAPGNARFGQGSGQIVLDDVRCSGHESYL
WSCPHRGWLSHNCGHHEDAGIICSAQKMSQPLRAWWCPRGHLTHPAHFITERAAQKRCPA
PAKWQEVARFRSTTVSTALPTTGTGSGLALRLVNGGDRCQGRVEVLYQGSWGTVCDDDWD
TNDANVVCRQLGCGWAISAPANAQFGQGSGQIVLDDVRCSGHESYLWSCPHRGWLSHNCG
HHEDAGVICSEFSKRSSAAVPSSTHRPVSGYTSPGTRRHDSLSCNLSLHSTDSGLALRLV
NGGDRCQGRVEVLYQGAWGTVCDDLWDTNDANVVCRQLGCGWAISAPGNALFGRGSGQIV
LDNVRCSGHESYLWSCPHGGWLSHNCGHSEDAGVICSASQNQSTARPVIFASPEPSLITL
GSDWWYPTTFFYVRHLTECGACPPSTTSCGLIALLEEKLSCPLLPSSSCPWDWFLQSLSV
RILLYIFLQLCPGPSILILLRAVSGGSQAPSVRDTSFIPQGSNEHSFFCSLTIKSGLFTG
MKLLSFWFSPVVLTSPVLSVVLPFTSALVIPGNSLHLEGLLILCFQSFLRPLLSAFLCDL
ILTVVSKPSISGVQVISHQAQVSGCNHVLTHQFSGPCRGSQLRLRDLDGTSLTSYHNFLR
GHMACDGQSPSVGFRAMRSKWPHEFYPQPLTSTPAVTTETDSGLALRLVNGGDRCQGRVE
VLYQGSWGTVCDDLWDTNDANVVCRQLGCGWAISAPGNARFGQGSGQIVLDDVSCSGHES
YLWSCPHRGWLSHNCGHYEDAGVICSELPSPIPPSPIPVDTSRPTISYSCGGFLSQTSGQ
FSSPFYPGNYPNNARCIWDIEVRSNHRVTVVFRDVQLESGCNYDYIEVFDGPYHSSPLIA
RVCNGVSGSFTSSSNFMSVRFISDGSVTRKGFQAEYYSSPSNDSTKLLCLQNHMQALVSR
SYLRSLGYVAQDLVIPGWSRSYQCQPQITSSQVIFTIPYVGCGTIKQADNDTIIYSNILK
ATVSNGIIKRKKDLNIRTSCRMLQNAWVDTMYIANDTIEVKEIQYGNFNVNISFYTSSSF
SYPVTSSPYYVDLNQDLYLQAEIRHSDSSLALFVDTCVASPYPNDFTSLTYDLIRSGCVK
DQTYRSYPQPSPRIARFKFSSFHFLNRFPSVYLKCKMVVCRAYDYNSRCYRGCVVRSKRN
AGSYQEKVDVVLGPVQLRVPEQWSLDLWVAGGEEQASFPSMVVSAGVFLVVVLVLVMVAF
MLRSRTRTTRG
Download sequence
Identical sequences G3UCK2
ENSLAFP00000025560 ENSLAFP00000025560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]