SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000025579 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000025579
Domain Number 1 Region: 198-315
Classification Level Classification E-value
Superfamily EF-hand 1.91e-34
Family Osteonectin 0.0093
Further Details:      
 
Domain Number 2 Region: 285-378
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.88e-25
Family Thyroglobulin type-1 domain 0.00065
Further Details:      
 
Domain Number 3 Region: 134-180
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000152
Family Ovomucoid domain III-like 0.006
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000025579
Domain Number - Region: 103-148
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.034
Family Haloperoxidase 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000025579   Gene: ENSLAFG00000015179   Transcript: ENSLAFT00000032150
Sequence length 423
Comment pep:novel supercontig:loxAfr3:scaffold_10:53991058:54015383:-1 gene:ENSLAFG00000015179 transcript:ENSLAFT00000032150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAPSCGRLALPLLLLAAAALAEGDAKGLKEGETPGNFMEDEQWLSSISQYSGKIKHWNR
FRDVSPDDYIKSWEDNQQGDEALDTTKDPCQKVKCSRHKVCIAQGYQRAMCISRKKLEHR
IKQPTLKLHGNKDTVCKPCHMAHLASVCGSDGHTYSSVCKLEQQACLSSKQLAVRCEGPC
PCPTEQAATSTTDGKPETCTGQDLADLGDRLRDWFQLLHENSKQNGSSSGASPTTGLDKS
LGASCKDSIGWMFSKLDTSADLFLDQTELAAVNLDKYEVCIRPFFNSCDTYKDGRVSTAE
WCFCFWREKPPCLAELERIQIQEAAKKRPGVFIPSCDEDGYYRKMQCDQSSGDCWCVDQL
GLELTGSRMHGSPDCDDIVGFSGDFGSGVGWEDEEEKDTEEAGEEAEEEEGEAGEADDGG
YIW
Download sequence
Identical sequences G3TEM3
ENSLAFP00000025579 ENSLAFP00000012709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]