SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000025739 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000025739
Domain Number 1 Region: 20-168
Classification Level Classification E-value
Superfamily vWA-like 3.56e-16
Family Integrin A (or I) domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000025739   Gene: ENSLAFG00000029305   Transcript: ENSLAFT00000036892
Sequence length 243
Comment pep:novel supercontig:loxAfr3:scaffold_12:37189011:37201896:-1 gene:ENSLAFG00000029305 transcript:ENSLAFT00000036892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GNPLQPTSLHYMSPYQLSAYAMALKAVGEIIQDYDSDKLFPAYGFGAKLPPEGRISHQFP
LNNNDEDPNCAGIEGVLESYFQSLRTVQLYGPTYFAPVINQVARAAAKISDGSQYYVLLI
ITDGVISDMTQTKEAIVSASSLPMSIIIVGVGPAMFEAMEELDGDDVRVSSRGRYAERDI
VQFVPFRDYVDRSGNQVLSMARLAKDVLAEIPEQLLSYMRTRDIQPRPPAPTNPSATPIP
EQP
Download sequence
Identical sequences G3UD31
ENSLAFP00000025739 ENSLAFP00000025739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]