SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000025801 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000025801
Domain Number 1 Region: 63-136
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.32e-18
Family Complement control module/SCR domain 0.0003
Further Details:      
 
Domain Number 2 Region: 125-193
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.31e-16
Family Complement control module/SCR domain 0.0000945
Further Details:      
 
Domain Number 3 Region: 193-254
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000124
Family Complement control module/SCR domain 0.00078
Further Details:      
 
Domain Number 4 Region: 256-316
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000459
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 5 Region: 2-73
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000526
Family Complement control module/SCR domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000025801   Gene: ENSLAFG00000025956   Transcript: ENSLAFT00000036757
Sequence length 395
Comment pep:novel supercontig:loxAfr3:scaffold_13:13024680:13050923:1 gene:ENSLAFG00000025956 transcript:ENSLAFT00000036757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GHCQTPKQFPFAKPTTAIDESEFPIGTYLDYKCLPGYSGSLFSITCLENLAWSSAEDACK
RKSCGYPPKPSNGMVLINTDIQFGSTINYSCNEGYQLIGSSSAACLLVSGNDVMWDKEAP
ICESISCEPPATIAHGYFNSSNRKLFQYGTVVTYYCHTGPSGEKLFDLVGETSIYCTSKD
DQLGVWSGPPPRCIPNECTAPEVENGIQESGNRRFFSLNEIVRFRCQPGFVMSGSRSVQC
QANNRWVPELPTCSREVKCSLPYFMNGIRKELNYKKIYHYGDNVTLECEYGYTLEGSPQS
QCQDDERWDPPLAMCTSRPNLNVFFFNITLLLYIHHTVMICLQPDALKFRNISSVGSAFK
KYFQECGARWQNEWTLPPSAPATNPWNNAYKQAQT
Download sequence
Identical sequences G3UD93
ENSLAFP00000025801 ENSLAFP00000025801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]