SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000025996 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000025996
Domain Number 1 Region: 191-303
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.81e-18
Family Spermadhesin, CUB domain 0.0046
Further Details:      
 
Domain Number 2 Region: 139-179
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000275
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 3 Region: 398-435
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000314
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 4 Region: 33-140
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000484
Family Spermadhesin, CUB domain 0.0025
Further Details:      
 
Domain Number 5 Region: 305-353
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000602
Family LDL receptor-like module 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000025996
Domain Number - Region: 356-397
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00126
Family LDL receptor-like module 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000025996   Gene: ENSLAFG00000028518   Transcript: ENSLAFT00000027777
Sequence length 709
Comment pep:novel supercontig:loxAfr3:scaffold_104:1560063:1564843:1 gene:ENSLAFG00000028518 transcript:ENSLAFT00000027777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPASLLFLLLGGALAHPDRIISPNPACKEPPAVLLEAQGTLQRPLGRESRSFPANCTWL
ILGSKEQTVTVRFQKLHLACGSEHLILHSPLQPLISLCQAPAGPLQLPGGNVTITYTYVG
GRAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVPWAQRCNGVDACGDGSDEAGCSSHPFL
GPTLAPVPAPPCNRTLEDFYGVFSSPGYSHLASGSHPQSCLWLLDPHDGRRLAVHFTALD
LGYGDAVHVYDGTGPPETTRLLRSLTYFSNGKAVTVETLSGQAVVAYHTVAWSSGRGFNA
TYHVRGYCLPWDRPCGSGSSLGAGEGLGERCYSEAQRCDGSWDCADGTDEENCPGCPPGH
FPCGPTGTPGATACYLPADRCNYQTFCADGADEKRCRHCQPGNFRCRDEKCVYETWVCDG
QPDCADGSDEWDCSYALPRKVITAAVIGSLVCGLLLVIALGCTCKLYAIRTQEYSIFAPL
SRVEAEIVQQQAPPSYGQLIAQGAIPPVEDFPVENPIDNSVLGNLRSLLQILRQDMTPGG
TSGARRRQRGRSVRRLVRRLRRWGLLPRTNPPARAPETRSQVTPSASPLEALDGSTGPAC
EGGAVGGQDGDQAPPLPVKAPLPSAGTSPAHSEAPGPLASPPLEPSLLSGMVQVLRGRLL
PSLHTPGAARALPGPHTVLSPEDEDDVLLLPLAEPEVWVVEAEDEPLLT
Download sequence
Identical sequences G3UDT8
ENSLAFP00000025996 XP_003420984.1.64505 ENSLAFP00000025996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]