SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000026478 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000026478
Domain Number 1 Region: 9-125
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-33
Family C-type lectin domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000026478   Gene: ENSLAFG00000030972   Transcript: ENSLAFT00000032616
Sequence length 126
Comment pep:novel supercontig:loxAfr3:scaffold_83:3391525:3395943:-1 gene:ENSLAFG00000030972 transcript:ENSLAFT00000032616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASKGCIKCEAPCPEDWLLYGRKCYFFSEEPRDWNTGRQSCHTHEAVLAVIQSQKELEFMF
KFTRREPWIGLRRVGDEFHWVNGDPFDPDTFPVSGPGECVFVEPTRLVSTECLMTRPWVC
SKMAYT
Download sequence
Identical sequences G3UF70
ENSLAFP00000026478 ENSLAFP00000026478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]