SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000026594 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000026594
Domain Number 1 Region: 2-128
Classification Level Classification E-value
Superfamily C-type lectin-like 5.07e-37
Family C-type lectin domain 0.00000291
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000026594   Gene: ENSLAFG00000030430   Transcript: ENSLAFT00000027818
Sequence length 131
Comment pep:novel supercontig:loxAfr3:scaffold_27:31574782:31576436:-1 gene:ENSLAFG00000030430 transcript:ENSLAFT00000027818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSTRISCPEGTNAYGSYCYYFNEDLVTWVDADLFCQNMHLGHLVSVLNQVEASLIKESRT
GNLNVWVGLHDPKKNHRWCWSSGSLVSYKAWKSGSPSSVSPGYCVSLTSTQKWKDKRCEA
KLSFVCKFKNK
Download sequence
Identical sequences G3UFI6
ENSLAFP00000026594 ENSLAFP00000026594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]