SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000026665 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000026665
Domain Number 1 Region: 66-174
Classification Level Classification E-value
Superfamily Second domain of FERM 2.09e-24
Family Second domain of FERM 0.0034
Further Details:      
 
Domain Number 2 Region: 175-279
Classification Level Classification E-value
Superfamily PH domain-like 7.99e-17
Family Third domain of FERM 0.01
Further Details:      
 
Domain Number 3 Region: 2-66
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000227
Family First domain of FERM 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000026665   Gene: ENSLAFG00000030561   Transcript: ENSLAFT00000031609
Sequence length 283
Comment pep:novel supercontig:loxAfr3:scaffold_69:11214397:11220165:-1 gene:ENSLAFG00000030561 transcript:ENSLAFT00000031609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVNLLGGSDESYFSFLFFLDNEYIFMDLEQKLSKYFSKDWKKETHKGGGKPHAPFVAFLR
VQYYVENGRVIRDRTAQHLYYCHLKEQVLRSECAHREEAYFLLAALGLQADFGNHREAAH
VGRGHEATATSPPHILAKRGSAYLLRHTPAMHREQRGLNPREAVLRFIREACRLDDVPVH
FFRLHKDKKEDQPTIVLGLTLKEVTSTREANHTRQLLYDFPWSRVGKLAFLGQRFEIQPD
GLPSARKLVYYTGCPVRSRHLLHLLSTSHQLHLRVQPVLRQLR
Download sequence
Identical sequences G3UFQ7
ENSLAFP00000026665 ENSLAFP00000026665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]