SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000026683 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000026683
Domain Number 1 Region: 283-459
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-58
Family SPRY domain 0.0000233
Further Details:      
 
Domain Number 2 Region: 4-72
Classification Level Classification E-value
Superfamily RING/U-box 9.28e-18
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 88-147
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000611
Family B-box zinc-binding domain 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000026683
Domain Number - Region: 133-236
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0157
Family Apolipoprotein 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000026683   Gene: ENSLAFG00000032447   Transcript: ENSLAFT00000032489
Sequence length 464
Comment pep:novel supercontig:loxAfr3:scaffold_276:123743:125137:-1 gene:ENSLAFG00000032447 transcript:ENSLAFT00000032489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALAGIWAEANCLICLDYFRDPVTIKCGHNFCGSCIQQSWEDQQDWFRCPVCCHPCLQLHL
RSNTQLGNIAAIAKLLHITRSKRKREEETRLCKKHNQVLTHFCEEDLEILCSLCTQPPNH
QDHLVRSIEEAASHHRKRLMSYMEPLKKQVADFQKLVTSQEREPSELRKKVEKQRKELFS
EFEHLNKFLDREHEAALSRLAREEKHVQQKLNANITAFSESISTLNSLLKEVAEKSVMSE
VKLLTDIQSVQNRCEGLNPPVLYSFQLTKEGCSLPPQYSALQKIIQKFKEDVTLDPETAH
SNLIVSADKKSVTFVKKTQRLPPNPKRFKFDPVVLGCEEFSSGRHYWEVEVGEKPEWSVG
LCKDSLSRKAKRPPAGQERCWAIQLCNGNYVAQGTFPVTLVITEQPRGIGIYLDYELGEI
SFYSLNDRSHIYSFTDRFSEILKPYFCIGRDSQPLTICAVRDYE
Download sequence
Identical sequences G3UFS5
ENSLAFP00000026683 ENSLAFP00000026683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]