SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000026938 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000026938
Domain Number 1 Region: 52-243
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-43
Family SPRY domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000026938
Domain Number - Region: 233-269
Classification Level Classification E-value
Superfamily SOCS box-like 0.00131
Family SOCS box-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000026938   Gene: ENSLAFG00000028630   Transcript: ENSLAFT00000027403
Sequence length 302
Comment pep:novel supercontig:loxAfr3:scaffold_53:14228505:14230229:1 gene:ENSLAFG00000028630 transcript:ENSLAFT00000027403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QHSDSDSDPEFLSLPPSIPSAVPVTGESFCDCDSQSEASFCGGRHSTHSGKDCRCGEEDE
HFDWVWDDLNKSSATLMSCDNRKVSFHVEYSCGAAIRGTKELTEEQDFWEIEMISPVYGT
DMMVGIGTSDVDLDKYHHTFCSLLGRDEDSWGLSYTGLLHHKGDKMSFSSRFGQGSIIGV
HLDTWHGKLTFFKNRKCIGVAATRLQNKKFYPMVCSTAAKSSMKVIRSCASSTSLQYLCC
YRLRQLRPNSGDTLEGLPLPPGLKQVLHNKLGWVLSMSCSLCWPPAPSPETRPCQRKHCR
RT
Download sequence
Identical sequences G3UGI0
ENSLAFP00000026938 ENSLAFP00000026938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]