SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000026984 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000026984
Domain Number 1 Region: 288-464
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-58
Family SPRY domain 0.0000249
Further Details:      
 
Domain Number 2 Region: 2-77
Classification Level Classification E-value
Superfamily RING/U-box 1.19e-23
Family RING finger domain, C3HC4 0.0076
Further Details:      
 
Domain Number 3 Region: 93-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000351
Family B-box zinc-binding domain 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000026984
Domain Number - Region: 138-241
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0432
Family Apolipoprotein 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000026984   Gene: ENSLAFG00000031853   Transcript: ENSLAFT00000037426
Sequence length 469
Comment pep:novel supercontig:loxAfr3:scaffold_554:7804:9213:1 gene:ENSLAFG00000031853 transcript:ENSLAFT00000037426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVMEALAGIQAEASCPICLDYFRDPVTIKCGHNFCRSCIQQSWEDQQDWFRCPVCRHPW
LQLHLRSNTQLGNIAEIAKLLHITRSKRKREEETRLCKKHNQVLTHFCEEELEVLCPLCT
QPPNHQDHLVRSIEEAASHHRKRLMSYMEPLKKQVADIQKLITTQDREPSELRKKVEKQR
KELFSEFEHLNKFLDREHEAALSRLAYEEKHIQQKLNANITAFSGSISTLNSLLKEVAEK
SVMSEVKLLTDIQSLQNRCEGLNPPVLYSFQLTKEGCSLPPQYSALQKIIQKFKEDVTLD
PETAHSNLIVSADKKSVTFVKKTQRLPPNPKRFKFDPVVLGCEEFSSGRHYWEVEVGEKP
EWSVGLCKDSLSRKAKRPPAGQERCWAIQLCNGNYVAQGTFPVTLVITEQPRGIGIYLDY
ELGAISFYSLNDRSHIHSFTDRFSEILKPYFCIGRDSQPLTICAVRDYE
Download sequence
Identical sequences G3UGM6
XP_003423628.1.64505 ENSLAFP00000026984 ENSLAFP00000026984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]