SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000027231 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000027231
Domain Number 1 Region: 3-137
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.59e-36
Family Galectin (animal S-lectin) 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000027231   Gene: ENSLAFG00000028381   Transcript: ENSLAFT00000032254
Sequence length 144
Comment pep:novel supercontig:loxAfr3:scaffold_45:4414977:4416666:-1 gene:ENSLAFG00000028381 transcript:ENSLAFT00000032254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALQFEAFYSGGLAPGWSLLVQGQSNSREDRFEINFLSESGDIAFHVKPRFSSATLVANA
FQDGSWGPEEVSSVFPLVLGEPFELEVHADAAHFHIHAQGLEVLHFEHRHRPLAAVTRVQ
VLSDRRLAQVELTKRGLSWEDSGN
Download sequence
Identical sequences G3UHC3
ENSLAFP00000027231 ENSLAFP00000027231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]