SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000027250 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000027250
Domain Number 1 Region: 10-150
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.91e-44
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00024
Further Details:      
 
Domain Number 2 Region: 124-307
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.29e-34
Family Laminin G-like module 0.013
Further Details:      
 
Domain Number 3 Region: 756-931
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.68e-34
Family Laminin G-like module 0.0027
Further Details:      
 
Domain Number 4 Region: 307-491
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.08e-33
Family Laminin G-like module 0.0048
Further Details:      
 
Domain Number 5 Region: 939-1144
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.21e-29
Family Laminin G-like module 0.012
Further Details:      
 
Domain Number 6 Region: 548-606
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000718
Family Fibrinogen C-terminal domain-like 0.0036
Further Details:      
 
Domain Number 7 Region: 520-556
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000212
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000027250   Gene: ENSLAFG00000027390   Transcript: ENSLAFT00000026016
Sequence length 1257
Comment pep:novel supercontig:loxAfr3:scaffold_109:437558:599371:1 gene:ENSLAFG00000027390 transcript:ENSLAFT00000026016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCEEPLLSALPPSSFSSSSELSSSHSPGFARLNRRDGAGGWTPLVSNKYQWLQIDLGERM
EVTAVATQGGYGSSDWVTSYLLMFSDSGRNWKQYRQEESISGFQGNVNADSVVLYRLRPP
LETRHLRFLPVAWNRDGRIGMRVELYGCAYRSEVINFDGNNSLIYRFTQSAMGPVKDVIS
LKFKTTQSNGILFHSEGRSGNHITLELVKGKLFLLISSGGAEPTHLPAPIHTALGSLLDD
QHWHSILLEHSGPRVNLTVDRHMEHFQASGDLDLHHEISFGGILAPGKSATFQSKNFHGC
LENIHFNGEDIVDLAKRHSPQVFIMGNVSFSCSQPQTMPLTFLSPRSSLALMGSPGEDGV
TVSFQFRTWNRAGRLLSSQLHQGSGNLLLILSDGSLRLSLHRSLEQRQSNITAGAGLNDG
QWHSVSFTAKRNRLSLKVDNNMASTAHMVVPMDIYSGETYYFGGCHPLTSGSECAQALAG
FQGCLREISINAQEVDLIAVQRGSLGNFSDLQVDTCSILDRCLPNYCEHGGKCSQTWNTF
YCNCSGTGYTGATCHHSLYEQSCEAYKHRGYSSGFYHIDPDGSGPLEPFLVFCNITVDAP
WTVLHHNSSSLTRVKGASPTRPHSADFQYQAGAGQLLATVMRAGHCQQELAYHCRRSRLR
EGPGGAPLSWWVGRTNETHTYWGGSLPDAQKCTCGLEGNCLDSQYVCNCDADQDEWMNDT
GLFSHKEHLPLMRIVITDAGRPGSEVVYRLGPLLCQGDRSFWNSASFHTESSYLHFPTFH
GELSADVSFFFKTTASSGVFLENLGITDFISLELRSPTEVAFSFDVGNGPCEVTVRAFGP
LNDNRWHLIHAERNTKEASLQVDLLPRVEQSAPTDGHVLLQLNSQLFVGGTATRQRGFLG
CIRSLQLNGQVLDLEERAKVTPGVEPGCPGHCSTYGHLCHNGGHCQERPRGFSCDCELSA
FTGPFCSDEISAYFGTGSSVTYNFQEYYSLSANSSSYAASFHGDMTLAREMISFSFQTVQ
TPSLLLYVDSFYKEYMSVILAKNGSLQIRYKLDIHQDPDVFNFNFKNMADGRLHHVKINR
EEGVVFVEVNQKTRRQTSLSSGTELHAVKSLVLGRILEPGSHLDPETARAGAEGFEGCLS
ALQFERAAPLKALLSPARPARTAIEAPVAASSCGARDSAAXXXXXXXXPLCFPAADHSGP
VGEGEPIADAARRDSAVIGGVIAVVIFVLLCIAAITTRLYQQKNLYKSKGAKRPEEE
Download sequence
Identical sequences G3UHE2
ENSLAFP00000027250 ENSLAFP00000027250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]