SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000027479 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000027479
Domain Number 1 Region: 1-72
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000332
Family MAM domain 0.0000722
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000027479
Domain Number - Region: 75-103
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00244
Family I set domains 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000027479   Gene: ENSLAFG00000032478   Transcript: ENSLAFT00000025733
Sequence length 114
Comment pep:novel supercontig:loxAfr3:scaffold_19:42108823:42133274:-1 gene:ENSLAFG00000032478 transcript:ENSLAFT00000025733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GALNVYVKVNGGPQGNPVWNVSGVVTEGWVKAELAISTFWPHFYQVIFESVSLKGHPGYI
AVDEVRVLAHPCRKAPHFLRLQNVEVNVGQNATFQCIAGGKWSQHDKLWLQVRM
Download sequence
Identical sequences G3UI21
ENSLAFP00000027479 ENSLAFP00000027479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]