SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000027482 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000027482
Domain Number 1 Region: 410-546
Classification Level Classification E-value
Superfamily FAS1 domain 5.49e-25
Family FAS1 domain 0.0023
Further Details:      
 
Domain Number 2 Region: 272-395
Classification Level Classification E-value
Superfamily FAS1 domain 7.59e-22
Family FAS1 domain 0.0018
Further Details:      
 
Domain Number 3 Region: 125-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000251
Family EGF-type module 0.049
Further Details:      
 
Domain Number 4 Region: 216-253
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000796
Family EGF-type module 0.046
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000027482
Domain Number - Region: 89-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000495
Family Merozoite surface protein 1 (MSP-1) 0.032
Further Details:      
 
Domain Number - Region: 2-46
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0247
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000027482   Gene: ENSLAFG00000028195   Transcript: ENSLAFT00000032219
Sequence length 566
Comment pep:novel supercontig:loxAfr3:scaffold_2:99402751:99449333:1 gene:ENSLAFG00000028195 transcript:ENSLAFT00000032219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LECPGGAGSPCSGRGRCDEGMEGNGSCSCQEGFGGTACESCADDNLFGPSCSAVCSCVHG
VCNSGIDGDGTCECYSAYTGTNCNKPIPECAALLCPENSRCSPSSEDETKLECKCLPNYK
GDGKYCEPINPCFQNICHPHAHCTYLGPNRHSCTCEEGYQGDGQVCLPADPCQVNFGNCP
TKSTVCKYDGPGQSHCECKEHYHNFVPGVGCSVTDICESNNPCHKNANCTTIAPGQTKCT
CQKGYVGDGSTCYGNIMERLRDLNTEPRGKWQGRLTTFISLLDKAYAWPLSNLGPFTVLL
PTDKGLKGFSVKELLMDNEAAQYFVKLHIIAGQMNTERLNNTDTFYTLTGKSGEVFNRDK
DNQLKLKLYGGKKKVKIIQGNMIASNGLLHIIDRAMDKMDPTFESNTEQTIMTMLQPRHS
KFRSLLEETNVGHALDEDGVGGPYTIFVPSNEALNNMKDGILDYLLSPEGSRKLLELVRY
HIVPFTQLEVATLISTPHIRSMANQIIQFNTTNNGQILANGVAMEEIEVAAKNGRIYTLN
GVLIPPSIIPILPHRCDETKREMKLV
Download sequence
Identical sequences G3UI24
ENSLAFP00000027482 ENSLAFP00000027482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]