SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000027533 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000027533
Domain Number 1 Region: 23-110
Classification Level Classification E-value
Superfamily Immunoglobulin 1.9e-23
Family V set domains (antibody variable domain-like) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000027533   Gene: ENSLAFG00000032030   Transcript: ENSLAFT00000036211
Sequence length 111
Comment pep:novel supercontig:loxAfr3:scaffold_104:67785:68299:1 gene:ENSLAFG00000032030 transcript:ENSLAFT00000036211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKLLVVSLVILWLQVDRVNGQVEQNPDALHIQEGENVTMNCSYKTTIKNLQWYRQDSGR
GLVLQILILSNEKEKPNGRLKATLDTSTKSSFLFITASQAADTATYFCALD
Download sequence
Identical sequences G3UI75
ENSLAFP00000027533 ENSLAFP00000027533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]