SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000027655 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000027655
Domain Number 1 Region: 888-996
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000653
Family Ankyrin repeat 0.0033
Further Details:      
 
Domain Number 2 Region: 703-781
Classification Level Classification E-value
Superfamily E set domains 0.0000000000436
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00012
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000027655
Domain Number - Region: 1348-1458
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00141
Family Motor proteins 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000027655   Gene: ENSLAFG00000001069   Transcript: ENSLAFT00000035662
Sequence length 1508
Comment pep:novel supercontig:loxAfr3:scaffold_26:14958105:15069454:-1 gene:ENSLAFG00000001069 transcript:ENSLAFT00000035662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNPDIVLVHYLNVPAIEDCGKPCGPILCSINTDKKEWAKWTKEELIGQLKPMFHGIKWTC
SNGNSSSGFSVEQLVQQILDSHQTKPQPRTHNCLCTSSLGAGSSVHHKCNSAKHRIISPK
VEPRSGGYGSHAEVQHNDVSEGKHEHSHSKSSSREKRNGKVAKPVLLHQNSTEVSSTNQV
EVPDTTQSSPVSISSGLNSDPDMVDSPVVTGVSSMAVASVMGSLSQSATVFMSEVTNEAV
YTMSPTAGPNHHLLSPDGSQGLVLAVSSDGHKFTFPTTGSSESLSMLPTNVSEDLVLSTT
LDGGRKIPETTMNFDPDCFLNNPKQGQTYGGGGLKAEMVSTNIRHSPPVERSFSFTTILT
KEIKTEDTSFEQQMAKEAYSSSAAATASSSLTLTTGSSLLPSGGGLSPSTTLEQMDFSAI
DSNKDYTSSFSQTGHSPHIHQTPSPSFFLQDASKPLPLEQNARSSLSDSGSTFVMPTVKT
EGSSQASSCSGHVETRIESTSSLHLMQFQANFQAMTAEGEVTMEASQAAEGSEVLLKSGE
LQACSSEHYLQPESNGVIRSASGMPILPGNVVQGLYPVAQPSLGNASNMELSLDHFDISF
SNQFSDLINDFISVEGGSGTIYGHQLVSGDSAALSQAEDGARAPFTQAEMCIPCCSPQQG
GLQLSSAEGGASTMAYMHVAEVVSAASAQSTLGMLQQSGRVFMVTDYSPEWSYPEGGEKV
LITGRLEYGSSLTSFQQAQVSGMLMSPATMKTFLPAHDTGLVTLQVAFNNQIISNSVVFE
YKARALPTLPSSQHDWLSLDDNQFRMSILERLEQMERRMAEMTGSQQHKQGAGGGGSSGG
GSGSGNGASQAQCASGPGTLGSCFESRVVVVCEKMMSRACWAKSKHLIHSKTFRGMTLLH
LAAAQGYATLIQTLIKWRTKHADSIDLELEVDPLNVDHFSCTPLMWACALGHLEAAVVLY
KWDRRAISIPDSLGRLPLGIARSRGHVKLAECLEHLQRDEQAQLGQNSRIHCPPSEEPNS
WMAQWHSDAISSPEIPKGVTVIASTNPELRRPRSEPSNYYSSESHKDYPAPKKHKLNPEY
FQARQEKLLSTALSLEQPNIRKQSPSSKQSVPETISPSEGVRDYSREFSPPTPETAGFQA
SGSQPVVKWNSKDLYIGVSTVQVTGNPKGTSVGKDAAPSQVRPREPMSVLMMANREVVNT
EMGSYRDSAENEECSQPMDDIQVNMMTLAEHIIEATPERIKQENFVPVESSALERTDTAA
ISSTMSWLATYLADVDHLPNAVQIRSAYNEPLTPSSNTSLSPVGSPVSEIAFEKPSLPSA
ADWSEFLSASTSEKVENEFAQLTLSDHEQRELYEAARLVQTAFRKYKGRPLREQQEVAAA
VIQRCYRKYKQLTWIALKYALYKKMTQAAILIQSKFRSYHEQKKFQQSRRAAVLIQKFYR
SYKKCGKGRQARRTAVIVQQRLRSSLLTKKQDQAARKIMRFLRRCRHSPLVDHRLYKRYT
QVSGGTSL
Download sequence
Identical sequences G3UIJ7
ENSLAFP00000027655 ENSLAFP00000027655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]