SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000027661 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000027661
Domain Number 1 Region: 12-114
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.83e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000027661   Gene: ENSLAFG00000006764   Transcript: ENSLAFT00000033029
Sequence length 526
Comment pep:novel supercontig:loxAfr3:scaffold_73:2300209:2372615:1 gene:ENSLAFG00000006764 transcript:ENSLAFT00000033029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDPSKQDILTIFKRLRSVPTNKVCFDCGAKNPSWASITHGVFLCIDCSGSHRSLGVHLS
FIRSTELDSNWSWFQLRCMQVGGNANASSFFHQHGCTTNDTNAKYNSRTAQLYRERVRSL
ASQATRKHGTDLWLDSCAVPSLSPPPKEEDFFASHVSPEVSGTAWASAQPELLSSTPKAV
ETTPENNEGGPEQGPSVEGLNAPTKAALAEVSSIIKKKPNQAKKGLGAKKGSLGAQKLAS
KSFNEIEKQAQAVDKMKEQEDLLARAAPKEESIVSSLRLAYKDLEIQMKKDEKMNISGKK
KIESERLGMGFGNCRSAISHSVTSDMQTIEQETPVMAKPRRKYSEDNDDSYFTSSSRASY
SFSCRYFDEPMELLSGSFSSWDDSSDSYWKKEAIKDTDTILRTAGYADRPTARRKPDYEP
VENTDEAQKKFGNVKAVSSDMYFGRQAQADYETRARLERLSASSSISSADLFEEQRKQPS
GNYNLTSVLPAAPDMAQFKQGVRSVAGKLSVFANGVMTSIQDRYGS
Download sequence
Identical sequences G3TYE8
ENSLAFP00000027661 ENSLAFP00000020606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]