SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000027759 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000027759
Domain Number 1 Region: 22-220
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.22e-37
Family Pentraxin (pentaxin) 0.000000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000027759   Gene: ENSLAFG00000029698   Transcript: ENSLAFT00000026272
Sequence length 222
Comment pep:novel supercontig:loxAfr3:scaffold_33:9027180:9028119:-1 gene:ENSLAFG00000029698 transcript:ENSLAFT00000026272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKLLLCFLTFLSLSIAFSETDMSKMAFVFPKESDDSFAKLISLRKQPLEAFTLCLCVYS
DLPRGYSIFSYNTRTQDNEILLFKDKPGEYSLSVGGTEVVFQHPDTFAPLHLCVTWESVS
GIVEFWVNRKPKVRKSLKKGYIVGSEASIVLGQEQDSFGGSFDIKQCLVGDIGDVNMWDL
VLSPGEINSVYRGNSFSPNVLNWHALRYEVHGEVFTKPQLWS
Download sequence
Identical sequences G3UIV1
ENSLAFP00000027759 XP_003415040.1.64505 ENSLAFP00000027759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]