SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000027922 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000027922
Domain Number 1 Region: 39-174
Classification Level Classification E-value
Superfamily C-type lectin-like 8.22e-38
Family C-type lectin domain 0.00000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000027922   Gene: ENSLAFG00000028709   Transcript: ENSLAFT00000027863
Sequence length 176
Comment pep:novel supercontig:loxAfr3:scaffold_27:31500481:31502826:1 gene:ENSLAFG00000028709 transcript:ENSLAFT00000027863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPPMALFSMSGMLLSCLMLLSQVQGEEDSPKEHSSARIKCPGGSKAYGSYCYALFLTPK
TWVDAEIACQKRSSGHLVSVLSVAEASFVASVVKSASNTYTNVWIGLHDPTLGLEPNAGG
WEWSSWDVLNYFAWERDPSTVLNSGHCGSLSRNTGFLKWKDYNCDQRLPYVCQFKN
Download sequence
Identical sequences G3UJB4
ENSLAFP00000027922 XP_003413753.1.64505 ENSLAFP00000027922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]