SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000027939 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000027939
Domain Number 1 Region: 34-245
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-62
Family SPRY domain 0.0000000272
Further Details:      
 
Domain Number 2 Region: 235-272
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000194
Family SOCS box-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000027939   Gene: ENSLAFG00000004961   Transcript: ENSLAFT00000004958
Sequence length 273
Comment pep:novel supercontig:loxAfr3:scaffold_41:18423959:18505098:-1 gene:ENSLAFG00000004961 transcript:ENSLAFT00000004958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQKLSGSLKSVEVREPALRPAKRELRGAEPGQPARLDQLLDMPAAGLAVQLRHAWNPED
RSLNVFVKDDDRLTFHRHPVAQSTDGIAARWGPPPGLHPWEVHLAGRQRGTHAVVGVATA
RAPLHSVGYTALVGSDAESWGWDLGRSRLYHDGKNRPGVAYPAFLGPDEAFALPDSLLVV
LDMDEGTLSFVVDGQYLGVAFRGLKGKKLYPVVSAVWGHCEVTMRYINGLDPEPLPLMDL
CRRTIRSALGRQHLRDIGSLPLPQSLKNYLQYQ
Download sequence
Identical sequences G3UJD1
ENSLAFP00000027939 ENSLAFP00000027939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]