SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000027991 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000027991
Domain Number 1 Region: 281-457
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-53
Family SPRY domain 0.0000362
Further Details:      
 
Domain Number 2 Region: 2-76
Classification Level Classification E-value
Superfamily RING/U-box 4.01e-20
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 93-145
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000128
Family B-box zinc-binding domain 0.0051
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000027991
Domain Number - Region: 131-230
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0445
Family Apolipoprotein 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000027991   Gene: ENSLAFG00000028830   Transcript: ENSLAFT00000035612
Sequence length 462
Comment pep:novel supercontig:loxAfr3:scaffold_379:57673:59082:1 gene:ENSLAFG00000028830 transcript:ENSLAFT00000035612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVTAALARIQAEANCPICLDYFRDPVTIKCGHNFCCSCIQQSWEGQQDRFPCPECRHPC
LQWHLRSNTQLGHIAEIAKLLHITRSKRKREEETCLCKKHNQEDLEVLCPLCTQLPDHQD
HYVRSIEEAASHHRKRLMSYMEPLKKQMAHFQKLVTTQDREPFELRKKVEKQRKELFSEF
EHLNKFLDREREEALSRLAREEKQIQQKLNANITAFSEYIPTLNNLLKEVAEKSVMSEVK
LLTDIKSVQDHCESLNPPVLYSFQLRKEGCSLSPQYSALQKIIQKLKEDVTLDPERAHRN
LFVSADKKSVTFVKKTQRLPPNPKRFKFDPVVLGREEFSSSRHYWEVEVGEKPEWSVGVC
KDSLSRKAKRPPAGQERCWAIQLCNGNYVAQGTFPVTLVITEKPRGIGIYQDYELGEISF
YSLNDRSHIYCFTDRFSEILKPYFCIGRDSQPLTICAVRDYE
Download sequence
Identical sequences G3UJI2
ENSLAFP00000027991 ENSLAFP00000027991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]