SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000028365 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000028365
Domain Number 1 Region: 142-269
Classification Level Classification E-value
Superfamily Second domain of FERM 1.7e-31
Family Second domain of FERM 0.0019
Further Details:      
 
Domain Number 2 Region: 273-374
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-25
Family Third domain of FERM 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000028365   Gene: ENSLAFG00000017551   Transcript: ENSLAFT00000026589
Sequence length 1628
Comment pep:novel supercontig:loxAfr3:scaffold_32:24170903:24224875:-1 gene:ENSLAFG00000017551 transcript:ENSLAFT00000026589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFFFQSPKSAFISAAKKAKLRSKPVKVQFSEQAAFGETDTVMMSREALGVVGRRRVVFLR
SMGGAAVSLSGLFSLPQDVMVTLQDRLSLRYIEHFALVLEYAGTEQNHKFLLLQDKQPLA
YVVQRTHYQGMKCLFRISFFPKDPVELLHRDPAAFEYLYIQSRNDVIRERFGMEPKPEML
LCLAALHIYITVSATRPSQKISLKNVEKEWGLEPFLPPSLLQGIKEKNLRKSLSQQLKAH
QTHPSSGTKGSAIQAKLQYLRILNELPTFTGVLFNTVGLGEKQSATTLLVGPRHGISHVI
DLKTNLTTVLSEFSKISKIQLFRENQGVARVETSIMDAKPLVLLMEWPEATNFACLIAGY
CRLLLDSRKMVFSRPASQPLPLPMIKADYMHSAHRPVTGGHLGKKESSYLGSVATSPRRS
SHCTPPPADSELVSFCYLHMREQRKEQESRMDVNENLIFFEETRPRTKSDPTSKSSGQGY
EVIPDDFDVASLDHEPCASRARSYTLDNSLGAESLNFYCDSCKAKLQEQLGPRKGGRPGS
CRDNMVDLMSLPPPGSEEEEEEEDESTSLLPAIAAPPPGFRDNSSDEDDTKRRAVQSQEQ
GRHLRGLLYDEIPVTLIDSVQTRTVRDHAQELDDALVSTLQALEALAASEDGPHPPPPQT
AGLIVLATITPESSLDSGHETNSSELTDMSEMMSAMKQHQNTTYFLAQHLNKDSLLARKD
LPFRIQTCAAQAVLTAPYSLGRPDPNPSRQPAVTGQSPGPPGARRKLPQSEAQLQGERTY
ALAVHPALPPQLSEQKNLSLLPPVPEDKGFGHARAGLEMSLRAATPSLSEEQTSELRENL
PKEVRLSPKLILDPKGSVTPAIISTALQQVVHSKSLATPGGPLGNPPSRGERRLEASMAR
PEVSMTSSSANKNLKFKMNPGGPERSQSSQQQSTSSSPRALTGSRAESLHISPQEDRMLG
QSFPPKSYLSRASRESLGKQAAGEGAGKGGPEGTKPALHKPGTASGQGEKGQLENTAKSS
KLEETSLVPRAGYPIALQSPSCQPRGHSPSIHPRGHSPSIQPRGHSPSCQPRGQSPLRPQ
VDSRQVSTMPSLKLETTLDGAHSVSEGPVKPKSSRGPFRLRNLFSATFPTRQKKETDERQ
AQLQKVKQYELEFLEELLKPPSQGELPGTEYLQPPAPGRCSCQLRSSPVQQGPGMSREQR
RSCDCKRICRGGRPQAAQTPMPSLQGRERDKVPPTQKQPEAGLGLSLSSPTNMQRIRSTS
LESRECRSDPESGVSCLSTCASGGECLGAPNYRKLMRRYSISEQDQGDRASLTSDVYPHP
PLGMLPREAKEVEAGLPLALGPKSKSLESPTLGEPSYVQVAPETKGPRQMAMFSLPEEVY
RKPAELDEDSESSKCCSIRYCFYYRKCDMADDASDGRDELSYSIPMKILPGMKLDEQVVP
VVSRTLQVLDAATCSSSSPEAARTQEIDLRVSTFEGSLAKINALRAHAYGLPDGFLAAQL
DTNELLTVLRQCVASPEARAPKPYVSQISEYKLELALKFKELRASCRRVANVDKSPTHML
AAITGSFQVLSSLIETFVRLVFIVRSEAQRQELLAKVEEVVRNYTFLLRAAEESTARNLN
QQQQQQQQ
Download sequence
Identical sequences G3TJ43
ENSLAFP00000028365 ENSLAFP00000014725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]