SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000028457 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000028457
Domain Number 1 Region: 82-275
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.54e-43
Family Pentraxin (pentaxin) 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000028457   Gene: ENSLAFG00000025581   Transcript: ENSLAFT00000036079
Sequence length 285
Comment pep:novel supercontig:loxAfr3:scaffold_49:2404387:2409366:1 gene:ENSLAFG00000025581 transcript:ENSLAFT00000036079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQYSRLNSSSQTNSLKDLLQSKIDDLERQVLSRVNSLEEGKGGLKNDTEERVKIESALTS
LHQRISELEKGQKENRPGDKFQLTFPLRTNYMYAKVKKSLPEMYAFTVCMWLKSSAAPGV
GTPFSYAVPGQANELVLIEWGNNPMEILINDKVAKLPFVINDGKWHHICVTWTTRDGVWE
AYQDGTQGGSGENLAPYHPIKPQGVLVLGQEQDTLGGGFDATQAFVGELAHFNIWDRKLT
PGEVYNLATCSTKALSGNVIAWAESHIEIFGGATKWTFEACRQIN
Download sequence
Identical sequences G3UKU8
ENSLAFP00000028457 ENSLAFP00000028457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]