SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000028556 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000028556
Domain Number 1 Region: 31-112
Classification Level Classification E-value
Superfamily Immunoglobulin 3.98e-18
Family V set domains (antibody variable domain-like) 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000028556   Gene: ENSLAFG00000025530   Transcript: ENSLAFT00000037378
Sequence length 112
Comment pep:novel supercontig:loxAfr3:scaffold_202:236945:237502:-1 gene:ENSLAFG00000025530 transcript:ENSLAFT00000037378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFQANEGSKMLSQAPVLTFLLLWVSGVSGDIMVTQSPVSLTVSLGGKVTISKSSQTVSSI
LAWYRQDAAQATKLLISFASEIPDGHPGSGSGADFTLTISSLQAEDEVDYCC
Download sequence
Identical sequences G3UL47
ENSLAFP00000028556 ENSLAFP00000028556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]