SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000029277 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000029277
Domain Number 1 Region: 127-195
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.34e-19
Family Complement control module/SCR domain 0.00081
Further Details:      
 
Domain Number 2 Region: 243-314
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.48e-18
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 3 Region: 303-372
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.56e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 4 Region: 184-254
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.04e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 5 Region: 4-72
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 6 Region: 423-491
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.13e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 7 Region: 361-418
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.28e-16
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 8 Region: 59-121
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000375
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 9 Region: 482-540
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000751
Family Complement control module/SCR domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000029277   Gene: ENSLAFG00000031770   Transcript: ENSLAFT00000033376
Sequence length 757
Comment pep:novel supercontig:loxAfr3:scaffold_20:4011218:4058622:1 gene:ENSLAFG00000031770 transcript:ENSLAFT00000033376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVNCSDPGFVENAIRQGQQNFPESFEYGISIMYHCKKGFYLLGSSALTCMANGLWDRSLP
KCLAISCGHPGVPANAILTGELFTYGTVVHYSCKGSRSLIGNNTRVCQEDSHWSGTLPHC
TGNNPGFCGDPGTPAHGSRLGDEFKTKSLLRFSCEMGYQLRGSPERTCLLNGSWSGLQPV
CEAVSCGNPGTPTNGMIISSDGILFSSSVIYACWEGYKTSGLMTRHCTANGTWTGTAPDC
TIISCGDPGTLANGIQFGTDFTFNKTVSYQCNPGYLMEPVTSSTIHCTKDSTWNQSKPVC
KAVMCSQPPQVQHGKVEGSDFHWGSSISYSCADGYQLSQSAILSCEGRGVWKGEIPQCLP
VFCGDPGTPAEGRLIGKSFTYKSEVFFQCKSPFILVGSSRRICQADGTWSGIQPTCIDPA
HNTCPDPGTPHFGIQNSSRGYEVGSTVFFKCRKGYHIQGSTTRTCLANLTWSGIQTECIP
HACRQPETPAHADVRAIDLPTFGYTLVYTCHPGFFLAGGSEHRTCKPDMKWTGKSPVCKI
PSDVFFINSVWKGYYEYLGKRQPATLTVDWFNATSSKVNATFVETSQVELKLTGVYKKEE
AHLLLKAIQIKGPVDIFVSKFENDNWGLDGYVSSGLERGGFTFQGDVHGKDFGKFKLERQ
DPLNSDQDSSNHYHGTSSGSVAAAILVPFFALILSGFAFYLYKHRTRPKVQYNGYAGHEN
SNGQASFENPMYDTNLKPTEAKAVRFDTTLNTVCTVV
Download sequence
Identical sequences G3UN68
ENSLAFP00000029277 ENSLAFP00000029277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]