SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000029291 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000029291
Domain Number 1 Region: 430-565
Classification Level Classification E-value
Superfamily TIMP-like 5.97e-31
Family Netrin-like domain (NTR/C345C module) 0.034
Further Details:      
 
Domain Number 2 Region: 207-302
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-20
Family I set domains 0.036
Further Details:      
 
Domain Number 3 Region: 382-435
Classification Level Classification E-value
Superfamily BPTI-like 1.7e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0023
Further Details:      
 
Domain Number 4 Region: 322-378
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000000136
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.018
Further Details:      
 
Domain Number 5 Region: 121-171
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000998
Family Ovomucoid domain III-like 0.033
Further Details:      
 
Domain Number 6 Region: 36-86
Classification Level Classification E-value
Superfamily Elafin-like 0.000000222
Family Elafin-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000029291   Gene: ENSLAFG00000008080   Transcript: ENSLAFT00000008079
Sequence length 574
Comment pep:novel supercontig:loxAfr3:scaffold_31:17710958:17715613:-1 gene:ENSLAFG00000008080 transcript:ENSLAFT00000008079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWALGCHQFWSHWRQVMALLLLLLGVPPQGGALPPIRYSHAGICPNDMNPNLWVDAQSTC
KRECETDQECETYEKCCPNVCGTKSCVAARYMDVKGKKGPVGMPKEATCDHFMCLQQGSE
CDIWDGQPVCKCKERCEKEPSFTCASDGLTYYNRCYMDAEACSKGITLAVVTCRYHFTWP
NTSPPPPETTVHPTTASPETPGLDTAAPALLNHPVHQSVTTGETVSFLCDVVGRPRPEIT
WEKQLEDRENVVMRPNHVRGNVVVTNIAQLVIYNAQPQDAGIYTCTARNAAGVLRADFPL
SVIRAGQASATAESITNGTAFPTAECLKPPDSEDCGEEQTRWHFDAQANNCLTFTFGHCH
RNRNHFETYAACMLACMSGPVAVCSLPALQGPCKAYAPRWAYNGQTGQCQSFVYGGCEGN
GNNFESREACEESCPFPRGNQRCRACKPRQKLVTSFCRSDFVILGRVSELTEEPDMGRAL
VTVDEVLKDEKMGLKFLGREPLEVTLLHVDWACPCPNVTVGETPLIIMGEVDGGMAMLRP
DSFVGASSTRRVRKLREVMHKKTCDVLKEFLGVH
Download sequence
Identical sequences G3UN82
ENSLAFP00000029291 ENSLAFP00000029291 XP_003414665.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]