SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000029313 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000029313
Domain Number 1 Region: 30-207
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.31e-65
Family SPRY domain 0.00000925
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000029313   Gene: ENSLAFG00000027503   Transcript: ENSLAFT00000036635
Sequence length 222
Comment pep:novel supercontig:loxAfr3:scaffold_243:31303:32492:1 gene:ENSLAFG00000027503 transcript:ENSLAFT00000036635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PMPHNTIKNWRKELFQAVPRVILSFLEVKQVIIFAVNVSLDPDTAHPNLILSEDRRRVTW
EEKPRDLPDDPQRFVSLPCVLGQQVISSGRRYWEVEVGDIGAWDLGICRDNVMRKGRVFL
KPEDGFWAIRLYNNEYWALTSPETQLTPKKHPARVCIFLEYEDRRISFYNMTDKSHIPTF
NQCLFYGSLRPFFRLWSADSGHLTICPASETAQPDDDPHRVP
Download sequence
Identical sequences G3UNA4
ENSLAFP00000029313 ENSLAFP00000029313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]